Re-Architecting Trust: The Curse of History and the Crypto Cure for Money, Markets, and Platforms
$16.07
Description
Book Synopsis: PRAISE FOR RE-ARCHITECTING TRUST
"You must read Omid. He is the best person to agree and disagree with on the subject of cryptos. You learn both ways and enjoy the argumentation in the process." Nassim Nicholas Taleb Author, The Black Swan
"Omid is a gifted storyteller, and in Re-Architecting Trust he uses a series of analogies and historical anecdotes to help the reader understand a complex topic. This book is important to prepare for the coming transformation to everything from money to the business models of artists and creators." Bill Block, CEO of Miramax
"I am cryptocurrency skeptic, but I found this book fascinating. Very well written, accessible, interesting and shining new light on the oldest thing in the world - money." Vitaliy Katsenelson Author, Soul in the Game
"Omid Malekan's Re-Architecting Trust is a well-warranted introduction to this domain, with the jargon stripped away and the theoretical underpinnings laid bare. Neither excessively utopian nor overly skeptical, Malekan is a balanced and thoughtful guide to this new frontier. His book is a profound contribution to the crypto literature." Nic Carter Partner, Castle Island Ventures & Co-founder, Coin Metrics
"Omid Malekan is my go-to source for all things crypto. This industry changes daily, but Omid always knows the latest and has good insight into what comes next. This book is THE resource I use to get a handle on the complexity of this revolution." James Altucher
"Omid continues to demonstrate his unique ability to synthesize the complexities of crypto in a clear and inviting way. This book provides the basis for appreciating the philosophical underpinnings of this still-developing frontier and why the old playbook will not serve the new world." Michael Moro, CEO of Genesis Global Trading
Re-Architecting Trust is a thought-provoking exploration of how decentralized blockchain networks and the digital assets that they enable can reinvent our most important trust frameworks by creating new types of money, reinvigorating how we transact the old kind, disintermediating the least trustworthy financial institutions, and enabling meaningful business models for artists and influencers. Omid Malekan, who has studied cryptocurrencies and blockchain for almost a decade, explains how the mishmash of technologies that enable Bitcoin can be applied to everything that matters to level the playing field, preserve your purchasing power, expand everyone's access to financial services, enable brand new business models, and elevate new new communities in an ever fracturing society. Known as the Explainer-in-Chief of crypto, Malekan has a unique ability to make complicated topics accessible to anyone. In Re-Architecting Trust he provides the reader with a guided tour of how money, markets, and platforms have evolved, where things have gone off the rails, and how we can restore integrity.
Details
reyuredyembrehefuureffedrevuzehewywerus?kfurherh"Re-rhegrus:heursefHsrydherypurefrMey,Mrkes,dPfrms".hsrymedbkhsreevedhghprsefrmreweduhrsdexpers,whssmhsebhgheuhr,mdMek,sheg-persfrsghsrypurrees.WhMek'sgffrsryegdhsbysmpfympexeps,hsbksheessegudeyueedvgehewrdfbkhehgyddgsses.
Mek'shugh-prvkgexprfdeerzedbkhewrkswpeyureyeshefepssbesheyffer.Dsverhwheseewrksreverusfrmewrks,reeewypesfmey,dempwerdvdusbydsermedguruswrhyfsus.hepefbkhgesbeydfe–revuzehewyrssdfueersdbusess,gvghemheshrverpdyhggsey.
"Re-rhegrus",Mekysumprehesverdmpfrheppfbkhehgy.Drwghsdede-gsudyfrypurrees,heexpshwheprpesbehdBbeppedrsfrmururresysems.Sygdbyemddemedheevepygfed,whereeveryehsessfservesdwhereegrysresred.
D'mssuhsppruybemeexperheryprevu.Mek'sbksmrehjusresure–'s.kehefrssepwrdsbeerfuurebydvghepgesf"Re-rhegrus".Equpyursefwhhekwedgedsghseededvgehempexesfhsevvgfrer.Wheheryu'reskeprbeever,hsbkwhegeyurpreepsdexpdyurudersdgfbkhehgydspempurves.
embrkhsrsfrmvejurey,k
Discover More Best Sellers in History & Culture
Shop History & Culture
4- and 8-bit Microprocessors, Architecture and History. (Computer Architecture Book 2)
$5.50


$38.93


The Blocksize War: The battle over who controls Bitcoin’s protocol rules
$21.99


Los Innovadores / The Innovators (Spanish Edition)
$8.54


America vs. Americans: How Capitalism Has Failed a Capitalist Nation and What We Can Do About It
$26.00


Race After Technology: Abolitionist Tools for the New Jim Code
$16.00


Self-Sovereign Identity: Decentralized digital identity and verifiable credentials
$43.49


Dawn of the New Everything: Encounters with Reality and Virtual Reality
$23.39
